PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.6864s0136.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 312aa    MW: 34502.2 Da    PI: 6.9258
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.6864s0136.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-18222256135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++Cg+ kTp+WR gp+g ktLCnaCG++y+  +l
  Bostr.6864s0136.1.p 222 CRHCGVQKTPQWRAGPSGAKTLCNACGVRYKTGRL 256
                          *******************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.9E-969306IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.097216252IPR000679Zinc finger, GATA-type
SMARTSM004014.5E-15216270IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.6E-14218279No hitNo description
Gene3DG3DSA:3.30.50.101.2E-14220254IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.32E-13221269No hitNo description
PROSITE patternPS003440222247IPR000679Zinc finger, GATA-type
PfamPF003201.7E-16222256IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVSVELALKN SNRNEKTLSG GAQNGDDFSV DDLLDFSNED DDVFVEEETD MKVQRKRGVS  60
DENTLHRSND FSTGDFPTSE LSVPMDDLAE LEWLSNFVED SFTTYSAAPT KKPVWSTGNR  120
RHPVPPVHDD SCFKAPPPIQ IRPKRARTGV SVWSHGSPSL TESSSSSATS SSSSSGFSSP  180
LWLADSEFLD EPMAKRQKKE MVCRNAGQTQ TQTQTQTQTR RCRHCGVQKT PQWRAGPSGA  240
KTLCNACGVR YKTGRLLPEY RPACSPTFSS ELHSNHHRKV IEMRRMKKTS DDADETGLTQ  300
NGSGCAEFLK K*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00404DAPTransfer from AT3G51080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0640480.0AY064048.1 Arabidopsis thaliana putative transcription factor (At3g51080) mRNA, complete cds.
GenBankAY1173150.0AY117315.1 Arabidopsis thaliana putative transcription factor (At3g51080) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190677.11e-141GATA transcription factor 6
SwissprotQ9SD381e-143GATA6_ARATH; GATA transcription factor 6
TrEMBLD7LTM81e-136D7LTM8_ARALL; Putative uncharacterized protein
STRINGAT3G51080.11e-141(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.11e-118GATA transcription factor 6